SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431927283|ref|YP_007240317.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431927283|ref|YP_007240317.1|
Domain Number 1 Region: 10-213
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.08e-53
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431927283|ref|YP_007240317.1|
Sequence length 234
Comment formate dehydrogenase subunit gamma [Pseudomonas stutzeri RCH2]
Sequence
MSHSNVRKGILRYGPWARANHWIVAICFVLLTLSGLALFYPAFFGLTALFGGPEPTRIVH
PYIGVFMTLFFLIQAVRFFRANLFRRYDVQWTRQIGDVLSNRDERLPPVGQNNAGQKLVY
WVFLATVPVLLVTGVVLWRPWVASEMPIWALRWAALIHALTAFVAILTLIIHVYSAIWVK
GSIRAMTQGRVSPAWARHHHKLWYDEVMAGEKRGDESALPHREPGDAAASRNRT
Download sequence
Identical sequences L0GLN1
gi|431927283|ref|YP_007240317.1| WP_015276971.1.47231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]