SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431927567|ref|YP_007240601.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|431927567|ref|YP_007240601.1|
Domain Number - Region: 46-124
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0785
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431927567|ref|YP_007240601.1|
Sequence length 145
Comment hypothetical protein Psest_2449 [Pseudomonas stutzeri RCH2]
Sequence
MVSFSGYLGLFLAAFGAATLLPMQSEAVLAGLLLSERYTVWALVAVASLGNVLGSLVNWL
LGRYVEHFRHKRWFPVNERQLAKAQHSYHRYGRWTLLLSWVPIIGDPLTLVAGVMREPLW
SFLLIVTLAKTARYLIVMGLTLGWM
Download sequence
Identical sequences L0GLX2
gi|431927567|ref|YP_007240601.1| WP_015277233.1.47231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]