SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431927571|ref|YP_007240605.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431927571|ref|YP_007240605.1|
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.26e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431927571|ref|YP_007240605.1|
Sequence length 198
Comment thiosulfate reductase cytochrome B subunit (membrane anchoring protein) [Pseudomonas stutzeri RCH2]
Sequence
MRERLYLFTRFERFWHWSQAALIITLLVSGFAAHGSHALVDFRSAVEIHEVSAWLLMLLW
VFGIFWHFTTGQWRQYTPTLSNIDRMLRYYVHGIFIGAPHPYKITVERKHNPLQRLSYLF
VKVMIGPLLWLTGLLYLFWERAQGLLSPWIDLQQVALLHTAGAFMMLIFLIVHVYLATTG
RTPLEHVRAMLTGWEEKH
Download sequence
Identical sequences L0GNQ2
WP_015277237.1.47231 gi|431927571|ref|YP_007240605.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]