SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431928365|ref|YP_007241399.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431928365|ref|YP_007241399.1|
Domain Number 1 Region: 13-277
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.22e-96
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.00000033
Further Details:      
 
Domain Number 2 Region: 281-397
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.14e-33
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|431928365|ref|YP_007241399.1|
Sequence length 403
Comment cytochrome b subunit of the bc complex [Pseudomonas stutzeri RCH2]
Sequence
MSKFMEWVDARFPATKMWEDHLSKYYAPKNFNVLYFFGSLALLVLVNQILTGIWLTMSYE
PSAEGAFASVEYIMRDVEYGWILRYLHSTGASAFFVVVYLHMFRGILYGSYQKPRELVWI
FGMMIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGGDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPLGVDIKKSKDENGVPLDGIPFHPYY
TVKDIVGVVVFLFVFCAVVFFFPEMGGYFLEKPNFEEANALKTPAHIAPVWYFTPFYAIL
RAVPDKLLGVIAMGAAIAVLFVLPWLDRSPVKSMKYKGWMSKVALLLFCISFVILGVLGV
LSPTPGRTLLSQICTAIYFGYFILMPFYTKLEKTKVVPQRVDG
Download sequence
Identical sequences L0GR30
WP_015278001.1.47231 gi|431928365|ref|YP_007241399.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]