SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431928538|ref|YP_007241572.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431928538|ref|YP_007241572.1|
Domain Number 1 Region: 290-413
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 8.91e-28
Family Flavohemoglobin, C-terminal domain 0.06
Further Details:      
 
Domain Number 2 Region: 404-513
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.8e-27
Family 2Fe-2S ferredoxin-related 0.013
Further Details:      
 
Domain Number 3 Region: 187-290
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 2.21e-23
Family Ferredoxin reductase FAD-binding domain-like 0.0042
Further Details:      
 
Domain Number 4 Region: 7-169
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0000000000000157
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|431928538|ref|YP_007241572.1|
Sequence length 518
Comment flavodoxin reductase family protein [Pseudomonas stutzeri RCH2]
Sequence
MAAFKRFRLFHWLLAGFFVAVYLSGDDAELLHVWLGYGLVALLVMRLLIAPLRLRGVPRL
LPAKMQRRNLSLTSFGTWLTFATLLSLALASLLGLGMVDNGDVLAALPGVGPDLFGSASD
IDFVGWLGDAEEVHEFFANLALTLVALHIGYVVLFRRTAAWAMLRGPRQPAEPGAPVSVA
ASEAPAFAALTVIARQAETADAASFSLQVPAELRERFAAQPGQFVTLRVPCSEPPLLRSY
SLSKPLGSDGVLRISVRRVPGGRASNWLLDNLQVGQRIDVLPPAGRLVPHDLDGDLLLLG
AGSGITPLRAILQAALEQGRGRVFLFYASRDAASLIFAEELADFAARYPERLQLRIWLDA
EQGIPSAPAIAAKIGDWPQGEAFVCGPQPFMDGASVALAELDVSSDAIHVERFNTAAPVA
PLSELRQPLHSRLQVALDGRRHALDVQQGEVLLDAMEQAGLQPPSACRAGVCAACRCRVV
EGSVSMRSNQVLSDQQVRQGWTLACQAVPTSTRLAVEY
Download sequence
Identical sequences L0GQ71
WP_015278164.1.47231 gi|431928538|ref|YP_007241572.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]