SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431929172|ref|YP_007242206.1| from Pseudomonas stutzeri RCH2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431929172|ref|YP_007242206.1|
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.39e-52
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.00000284
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431929172|ref|YP_007242206.1|
Sequence length 207
Comment formate dehydrogenase subunit gamma [Pseudomonas stutzeri RCH2]
Sequence
MNNNEIERYNPSQRTNHWIVAILFVLAALSGLALFHPALFGLSGLFGGGTWTRILHPFIG
VAMFVFFLWLAIRFAGHNRIEARDRQWLRQINDVVHNREDRLPEVGRYNAGQKVLFWVLI
LSMLVLLLSGIVIWREYFSSFFGIVSLRWASLLHAIAAFVLIVSIIVHIYAAIWIKGSMG
SMLYGTVSRAWARKHHPAWYREITERK
Download sequence
Identical sequences A0A023WXJ7 L0GRF9
WP_015278740.1.47231 WP_015278740.1.50587 gi|431929172|ref|YP_007242206.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]