SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_000610m|PACid:17980095 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_000610m|PACid:17980095
Domain Number 1 Region: 130-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 5.1e-43
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 1012-1077
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000186
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_000610m|PACid:17980095
Sequence length 1111
Sequence
MKMPANGAGVSSAATTSCVTTSNPSEGGEKKSINPELWQACAGPLVSLPAAGTLVVYFPQ
GHSEQVAASMKKDVDAHIPNYPSLPSKLLCLLHNVTLHADPETDEVYAQMTLQPVPSYDK
EALLRSDLSLKSNKPQTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQEL
VARDLHDNVWTFRHIYRGQPKRHLLTTGWSLFVSGKRLFAGDSVLFIRDEKQQLLLGIRR
ANRQPANLSSSVLSSDSMHIGILAAAAHAAANNSPFTVFYNPRASPSEFVIPLAKYYKAV
CSNQVSLGMRFRMMFETEESGTRRYMGTITGISDLDPLRWKNSQWRNLQVGWDESTAGER
RNRVSLWEIEPVTAPFFICPPPFFRSKRPRQPGMPDDDSSDLDNLLKKSMPWISDDFYMK
DPQSVPGLSLVQCFNMQQNPSLANSLQPNYMQSFPGSVLQNLTGADLSRQLGLAVPQLPQ
PNNLQFNAQRLPLQSQPLDQLPKLPSSLNPLGSIMQSQQQLGDISQQSKQNLVTQTIPSS
QVQAQILQPQTLVQNANILQQQPSFQSHQLPRNLPQTLQQNQQQHIVGQNQQQGVTQTQM
TDQVNQQLQMSDNQIQLQLLQKLQQQQQSLLMQQSVLQQPNQFVQLQDPQKQLLEASQSF
SRSMRTNQLLEMPQTAPTSLPQSNIIQQQMTKNGNQTNAQFSHMPQQLKFQQQQPGILPE
LPGQMGLPPSSGINHLPTVGSGTLTAAGAGISGITEELPSCSTSPSTNNCVNVVHRVHQT
TAMGDDMAQSAATLMSPNALETMSCSANLVKDVQQKSDVKPSLNIAKNQKQGFFAPQTYQ
NGAMAQTDYLDTSSSTTSVCLSQNDVHLQQNNNSSSYNPHSMLLRDISQDGELQADPRNN
VPYGANVDDQLGVPMNSEQVLTKGITGLGKDLSNNLSSGGMLSNCENSKDPQHELSSSMV
SQSFGVPDMAFNSIDSTINDSSFLNRGPWAPPPQFQRMRTYTKVYKRGAVGRSIDITRYS
GYAELKQDLARRFGIEGQLEDGQRIGWKLVYVDHENDVLLVGDDPWEEFVNCVRCIKILS
PQEVQQMSLNGDFGNPVLPNQACSSSDNGNA
Download sequence
Identical sequences A0A2C9WHS3
cassava4.1_000610m|PACid:17980095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]