SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001357m|PACid:17970373 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001357m|PACid:17970373
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.05e-49
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 756-839
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000183
Family PB1 domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001357m|PACid:17970373
Sequence length 897
Sequence
MRLSSAGFNPQTQEGEKRVLNSELWHACAGPLVSLPAVGNRVVYFPQGHSEQVAASTNKE
VDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDAYLPAELGTPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRANRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPPFPLRLKRPWPPGLPTFHGIKDDDLGMNSPLMWLRGDGDRGIQSMNFQGIGVTP
WLQPRVDASMLGLQTDMYQAMAAAALQEMRAIDPSKPSTASIVQFQQQPNFPSRTGSLMP
PQMLQQSQPHTAFLQGVQENQHQPQSQSQTQSHLIQQQLHHQHTFNSQQQQQLPQQQLVE
HQQMSNVVSAISQFASASQSQSPPLQAISSLCQQQSFSDSNGNPVTSSVVSPLHSLMGSF
SQDESSHLLNLPRTNALVTSSGWPSKRAAVEPLISAGAPQCVLPQVEQFGAHQTNISQNA
VSLPPFPGRDCSIDQDSGTDPQSHLLFGVNIEPSSLILQSGMSSLRGVGSDSDSTTVPFS
SSNYMSTTGTDFSLNPAMTPSSCIDESGFLQSPENVGQVNSSTKTFVKVHKSGSFGRSLD
ISKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWPEFVNSVWC
IKILSPQEVQQMGKRGLELLNSVPIQRLSNGSCDDYASRQDSRNLSSGITSVGSLDY
Download sequence
Identical sequences A0A2C9UGD0
cassava4.1_001357m|PACid:17970373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]