SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001567m|PACid:17965008 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001567m|PACid:17965008
Domain Number 1 Region: 157-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.27e-40
Family B3 DNA binding domain 0.0034
Further Details:      
 
Domain Number 2 Region: 727-808
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000343
Family PB1 domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001567m|PACid:17965008
Sequence length 857
Sequence
MMDSSEISIKGNGGNVRGDSFSSPYSEPNDPRNAMEGQKSHSTCPVSARDAETALYTELW
HACAGPLVTVPRERERVFYFPQGHIEQVAASTNQVADQQMPVYDLPSKILCTVINVQLKA
EPDTDEVFAQVTLLPDPNQDESAVDKEPPLPPPPRFHVHSFCKTLTASDTSTHGGFSVLR
RHADECLPPLDMSKQPPTQELIAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLV
AGDAFIFLRGENGELRVGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVY
YKPRTSPAEFIVPVDRYMESVKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRW
RDSKWRCLKVRWDETSTIPRPERVSPWSIEPALAPPALNPLPMPRPKRPRSNVVPSSPDS
SVLTREGSSKVTIDPQPPSGYSRVLQGQEFSTLRGNFAESNESDTAEKSLMWPSSIEDEK
VDVVSASRRHGSESWMPSGRQEPTYTDLLSGFGAHADSIHGFGASFVDQTAASASRKLIL
DQEGKFNLPSSHWSVMSSGLSLKLPESNAKVPVQGRDMPFQARGHIRCSAFNELPMLNGH
RVEQSHGNWLMPPPPPSHFDNQTHARDLGPKPILVPEHETGKSTDGKCKLFGIPLFSNPV
TPEPAAHRSMVYEPTSAHPQCHQLRALECDQRSEQSKGSKLADDNEHEKQFQGGILHTRD
NQGKAQSVSTRSCTKVHKQGIALGRSVDLTKFNNYNELIAELDQLFEFDGELMAPKRNWL
IVYTDDEGDMMLVGDDPWQEFVGMVRKIYIYTREEVQKMNPGALNSKGDENLLDVEGMDA
KDMKCLRLPPANSTDIC
Download sequence
Identical sequences A0A2C9VRR2
cassava4.1_001567m|PACid:17965008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]