SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001979m|PACid:17980934 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001979m|PACid:17980934
Domain Number 1 Region: 148-268
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.7e-44
Family B3 DNA binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 659-742
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000432
Family PB1 domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001979m|PACid:17980934
Sequence length 787
Sequence
MEIDLNHAVTEVEKNAFCTNGDSSSSSCSSNSAPSPLPSSIYLELWHACAGPLTLLPKKG
NVVVYFPQGHLEQVASSAPFSPMEMPTFDLQPQIFCKVVNVQLLANKENDEVYTQLTLLP
QPQLVGQDLEGKELEELVVDEEGGGRLPAKSTPHMFCKTLTASDTSTHGGFSVPRRAAED
CFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAV
LFLRGEDGELRLGIRRAVRPRNGLPDSVIGKQNSYPSVLSVVANAMSTNSMFNVLYSPRA
SHAEFVVPYKKYMKSIMNPVCIGTRFKMRFEMDDSPERRCSGVVTGISDLDPYRWPNSKW
RCLMVRWDEDIVSDHQDRVSPWEIDPSVSLPPLSIQSSPRLKKLRTGLSATPPDNPITGG
GGFLDFEESGRSSKVLQGQENVGFASPLYGRDTLNRPPDFGMQNMAHQNLVSTGREKADI
GEITRARSTTYTGFAESDRFPKVLQGQEICPLRSLTGKSDLNLSAWCRPNLGCGPFNTYQ
APRPSFYPLAAESLQKMYITYGDLHKTGQDPRMSSYATKFPREKLPFDASSVQTGAARDV
VGKPNQSSEHKSQEIISASPGLGANLINQKENSFNGTASGCKLFGFSLTADSPTPNSQNS
GKRSCTKVHKQGSLVGRAIDLSRLNGYGDLLNELERLFSMEGFLRDHNKGWRILYTDSEN
DVMVVGDDPWHEFCNVVSKIHIYTQEEVEKMSIGVIGDDTQSCLDQAPVVLEASKSSSVG
QPDSSPQ
Download sequence
Identical sequences A0A2C9V2F3
cassava4.1_001979m|PACid:17980934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]