SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001995m|PACid:17968878 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001995m|PACid:17968878
Domain Number 1 Region: 147-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.03e-45
Family B3 DNA binding domain 0.0036
Further Details:      
 
Domain Number 2 Region: 660-740
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000589
Family PB1 domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001995m|PACid:17968878
Sequence length 785
Sequence
MEIDLNHAVTEVEKNAFCTNGDSSSSSCSSNSSPSPASSSIYLELWHACAGPLTSLPKKG
NVVVYFPQGHLEQVAYSAPFSPVEMPTFNLHPQIFCKVVNVQLLANKENDEVYTQLALLP
QPELVGQKLEGKELEDLGVDEEGGAGLPAKSTPHMFCKTLTASDTSTHGGFSVPRRAAED
CFPPLDYKQQRPSQELVAKDLHGVEWRFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAV
LFLRGENGELRLGIRRAARPRNVLPDSVIGKQNSYPSVLSPVANAISTNSMFNVLYSPRA
SHAEFVVPYKKYMKSIMNPVCIGTRFKMRFEMDDSPERRCSGVVTGKSDLDPYRWPNSKW
RCLMVRWDEDIGSDHQERVSPWEIDPSVSLPPLSIQSSPRLKKLRTGLPAMPPDNPITGG
GEFLDFEESGRSSKVLQGQENVGFVSPLYRGDTLNRSPDFEMQNLAHQNLVSIGREKANI
GEITRARSTTYTGFAESDRFPKVLQGQEICQLRSLTGKSDFNLGAWGKPNLGFGPFNIYQ
APRANFYPLAAESLQNMYFHYGDIYKTGQDPRMRSYATNFPRENFQFGASSMLTARDEVG
KSNQSHEHKPQETISATPALGVNLINQEDNSFNGTSSGCKLFGFSLTAESAIPNSQNSGK
RSCTKVHKQGSLVGRAIDLARLNSYSDLLVELERLFSMEGLLRNPNKGWQILYTDSENDV
MVVGDDPWHEFCNVVSKIHIYTQEEVEKMTIGVIGDDTQSCLDQAHAVMEASKSSSVGQP
DFSPQ
Download sequence
Identical sequences A0A2C9W097
cassava4.1_001995m|PACid:17968878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]