SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_002216m|PACid:17983384 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_002216m|PACid:17983384
Domain Number 1 Region: 121-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-38
Family B3 DNA binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 637-713
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000000025
Family PB1 domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_002216m|PACid:17983384
Sequence length 758
Sequence
MIIAGSSADNDCNGIAIADSGDALYRELWHACAGPLVSVPRQGELVYYFPQGHIEQVQAS
TNQVADQQMPAYDLPAKILCRVVNVQLKAELDTDEVFAQITLLPQHEQDAKLVEEALPPP
TRPRVHSFCKTLTPSDTSTHGGFSVLRRHADECLPPLDMSLQPPAQELVAKDLLGNKWHF
RHIFRGQPRRHLLQSGWSLFVSAKKLVAGDAFIFLRGENGEIRVGVRRAMRQPSNIPPSV
ISSHSMHIGILATAWHAVSTGTMFTVYYKPRTSPAEFIIPVDKYDESVKSSFTTGMRFKM
RFEAEEAPEQRLSGTVVGVEQADPKRWPASKWRCLKVRWDETSPIHRPEKVSPWEIEPAS
APSLNSLPACRIKRPRSNMAMHSADSAASIKKDNGLSRDLQDQENETLRSTFAVSKFQET
AQNPSRGSSLHVKDQNCTYFGKRRFEHESRNPQLGLGEKYLNAALGQQTPHDSGEFGQHL
VDLIPDTAGQLKKHVVDEENKLNWCSLSIMHSGPSLNMCEPILEPHTSKDKEICPTSWNL
KSTFLRQSDYVQGMEVDYQPGQRILSQGCAGNSPIATEKLHPLSLQLHEEDMGSNLSLQE
FKNPKCSESIIRCDEEKSFLASDNFVLNKTQGGLTRRCVKVQKQGIGVGRSVDLTKFNNY
DEFLAELDQIFEFNGELVAPNKNWLVVFTDDEGDMMLVGDDPWQEFCSMVRRILIYTREE
INRMDPRSLNTIVEENSTVADHIAVEDKSSKHLPTASV
Download sequence
Identical sequences A0A2C9VF48
cassava4.1_002216m|PACid:17983384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]