SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_002980m|PACid:17967195 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_002980m|PACid:17967195
Domain Number 1 Region: 114-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.27e-30
Family B3 DNA binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  cassava4.1_002980m|PACid:17967195
Domain Number - Region: 594-666
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00102
Family PB1 domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_002980m|PACid:17967195
Sequence length 678
Sequence
MIRDFGVMKSQRVAEKCLDSQLWHACAGGMVQVPPVNSKVFYFPQGHAEHAQGNVDFANC
KIPAMIACKVSAIKYLADPETDEVFAKIRLIPLSDRDVEFMEDGSDDVLFDGTPQQEKPA
SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTIIAKDVHGETWKFRHIYRG
TPRRHLLTTGWSNFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGVGGGNECPSGWNSF
GGYSGFLREDESKLMRRNVNGDMKGKLRPESVIQAATLAANGQPFEVVYYPRASTPEFCV
RASAVRASMQIQWCLGMRFKMAFETEDSSRISWFMGTISSVQVADRIRWPSSPWRLLQVA
WDEPDLLQNVKRVSPWLVELVSNMPSVHLSPFAPPMKKLRLPQSPDFSLIGQLPLPSLTG
NPLGSNIPLCSVSDNIPAGIQGARHAQFELSSADFHFQKLQSTLFPAGIKHLDHAAPTSR
IPNRNFMGIAENKEKISCLLTMGNPTLSLKGNSETKVPHIMLFGQLILPDQQSSQSCSGD
TNGNSSSDGNPEKMANLSDGSVFHQTGLLENSSDEGSPRYKDHQKTDLSLDTGHCKVFME
SEDVGRTLDLSVLGSYEELYKKLANMFSIENSDTLSSVLYRDAAGAVKHTGDEPFSEFLK
TARRLTILTDSSSDNIGR
Download sequence
Identical sequences A0A2C9V4I0
cassava4.1_002980m|PACid:17967195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]