SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_004042m|PACid:17964413 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_004042m|PACid:17964413
Domain Number 1 Region: 487-588
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1e-22
Family B3 DNA binding domain 0.0097
Further Details:      
 
Domain Number 2 Region: 11-110
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-22
Family B3 DNA binding domain 0.00083
Further Details:      
 
Domain Number 3 Region: 260-358
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-22
Family B3 DNA binding domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_004042m|PACid:17964413
Sequence length 598
Sequence
MEKQNQAEMVNTSRPCFFEIFSSNLTSDRLRIPVGFTKHMEGRISGLVSLTGPSGNVWHA
YLTQQDNDVFLDHGWPTFVKDHLIECGDVLIFRYDGELCFSVQVFDISACEKEAAFHSKC
SQDPSQLYKSIGQKREREERAASSDKNCEYVLKKVRGDSSELYSEHINKSLGAGLVISNK
EGCQLEEVNTTKKCPEESSSHEKCYSPCPISVIPPQSKPCYQSSDVQKRIGKEDDLPDRG
CGSVLLQREKRVAQSFISCFPYFVRIMKRFNVSGSYTLNIPYQFSTAHLPNCKTEIVLRT
VKGACWSVNSVPTTRVHTSHTFCGGWMAFVRSNDIKIGDVCIFELVRKCELRVFILRVGK
EVLEKQSGEVASNEATVGCTATAHKSDIFPKKSRKNALKVHSRPITKVEMCDKKDSNKSQ
VASNHARKCSNAIKSSASAMLCSQSRAVNEKLDVAINSGKNLDVSSHDGVGGRVMLALHE
EKAAKSFNSRFPNFVRIMRKFNISGSYTLKIPHQFSAAHLPNCKTEIVLRNSQGICWTVN
AVPDSKGRRIHTFCGGWMAFVRDNYINMGDVCIFELVSKCEMLVHISGVGGKTLQPPS
Download sequence
Identical sequences A0A251KYL8
cassava4.1_004042m|PACid:17964413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]