SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_013029m|PACid:17988785 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_013029m|PACid:17988785
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-24
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 195-290
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-19
Family B3 DNA binding domain 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_013029m|PACid:17988785
Sequence length 293
Sequence
MENAPHFFKIILDSTIRQRKLAIPRKFVKKYGNCLSSPVILSVPSGTIWRVELLKCNDDV
WLGQGWQDFSNYYSLERGSFLVFKYEGECRFHVVIFDKSASEIEYPYSNSHNANPNHDEL
QDIKIEENEDDISVKALDVLSQCKKVEEKSTFLHPQSRKVMQSRCKKNDRRKVGRPPSFP
ITSQALEAANNYVAKYPSFTVLMKRYHWENGIVVLPSSFFVRHFECKTQSIMLQNADRFW
PVKLISSSDSTRASFSAGWRVFSRENAIEVGDACVFELIKRNVLNVTIFRCVD
Download sequence
Identical sequences A0A2C9VMX1
cassava4.1_013029m|PACid:17988785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]