SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_013238m|PACid:17989499 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_013238m|PACid:17989499
Domain Number 1 Region: 18-113
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-26
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 193-284
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000124
Family B3 DNA binding domain 0.0077
Further Details:      
 
Weak hits

Sequence:  cassava4.1_013238m|PACid:17989499
Domain Number - Region: 101-141
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00252
Family alpha-Amylases, C-terminal beta-sheet domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_013238m|PACid:17989499
Sequence length 287
Sequence
MTSLAGKSQDEIFTVRRKPTRFFKIILENTIREGKLGIPTKFVKDYGNCLSSPVTLTDPT
GNSWKVDLLKNGNDVWLEKGWPEFSENHSLKYGHFLVFEYKGDSHLHVFIFDESAVEIEY
SGKLNFDGNSPLPKKQEDGDQDIIYLHTTRSGNQSKEKQKQVMAAKGRNWQIERPKSAKT
CGALQAANNFISNYPFFKVLLRRTLDVNVPFSLIRRYMKCESQILMLHVAEKSWPVKLNV
YSNRRIASLARGWTAFARENCLEAGDICIFEMIERNVLNVFMFRCAC
Download sequence
Identical sequences A0A2C9V310
cassava4.1_013238m|PACid:17989499

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]