SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_020082m|PACid:17966461 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_020082m|PACid:17966461
Domain Number 1 Region: 20-96
Classification Level Classification E-value
Superfamily TSP9-like 2.22e-25
Family TSP9-like 0.0000981
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_020082m|PACid:17966461
Sequence length 96
Sequence
MASLPIAFAAPTFRVYAATAAKEAGGSKEEKGFLDWILGNLQKEDQFYETDPILQKVEGK
NGGGTTNGRKNSVSVPQKKKGNGGGFGGFGGLFAKK
Download sequence
Identical sequences A0A2C9WEP5
cassava4.1_020082m|PACid:17966461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]