SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_021264m|PACid:17985936 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_021264m|PACid:17985936
Domain Number 1 Region: 57-153
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.16e-20
Family B3 DNA binding domain 0.0074
Further Details:      
 
Domain Number 2 Region: 171-266
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.08e-16
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_021264m|PACid:17985936
Sequence length 287
Sequence
RDMVFDVIVSDPSSCQREYLSFNVKEEIETPEAEEAAKESGPASEDNLEGKAGALLEHPF
FVVTVTFYRARFYNFKQNVPMKFAQANDLKNRSCKIVLMDQEARAWPAKLGHKKSDGQVY
IGQGWSAFCVANHLKAGDSFLFELIKKGRWPILQINEEETDNAAESGCFSSTHPCFYVTV
KTYHFKNYHLKIPRNFARMNRLSRKCFKMILTNEKGSSRVVLVGKSKSGDVAIGRGWNAF
AKENGLREGYVIMLELVKGGVKPVMKIYVNQGIRNSQGGQLGKSSGC
Download sequence
Identical sequences A0A2C9UB03
cassava4.1_021264m|PACid:17985936

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]