SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_021291m|PACid:17971078 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_021291m|PACid:17971078
Domain Number 1 Region: 159-273
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000471
Family B3 DNA binding domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_021291m|PACid:17971078
Sequence length 276
Sequence
MEKLDYFHVFSAQASMKDQLFAANQSDKKRNHRYILDVQENNAVSTELTLHCGFPSMIKK
PRTTPISSSSFLHSSIVVSTRPAKEEEVSTKLKLFDETWVADHDASATRKEPDGVSKESS
ELKTLARDTANERIYSPEEERKMRLKHPVWTKLVLYDPWKIKKRLTGSDLGNHCRLLVTS
ALVKNHIFPFMGSEIIEKIRGEGAEFCFWDCDTNTELNLVLKYWHTSKSYIFNKGWPNNF
VKRRNLVGGDLIGIYWDSTKKIFNFAVLERACEVYP
Download sequence
Identical sequences A0A2C9U2J5
cassava4.1_021291m|PACid:17971078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]