SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_021579m|PACid:17973413 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_021579m|PACid:17973413
Domain Number 1 Region: 181-280
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.57e-26
Family B3 DNA binding domain 0.00021
Further Details:      
 
Domain Number 2 Region: 50-106
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000399
Family GCC-box binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_021579m|PACid:17973413
Sequence length 370
Sequence
MEKDACSCLLSNAKINAAETSDSCDSFYNPFRLAKRPRLDLNNNITVAAKFKGVVSQQNG
HWGAQIYANHQRIWLGKFKSDKEAAMAYDSAAINLRSGDSQRNLPWTERNIQEPNFQSQY
SIEVILSMIKDGSYQPKFSDFLRKQSRRQEAAAAAGLSLNNNINNNQTGVPSGDGQFSCI
QLFQKELTPSDVGTLNRLVIPKRFAIKYFPCITGNMEEDDNGEGGEREDTELVFYDRLMK
CWKFRYCYWRSSQSFVFTRGWIRFVKEKNLKEKDVVTFYACVSPEIQRVQEGHQFSLIDI
SYSNGGQSCSVGDGPCEIDEMQKELELNLGQTVGKKLQKDHQAKGNRKRGLELNNTAKGK
RLRLFGVRID
Download sequence
Identical sequences cassava4.1_021579m|PACid:17973413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]