SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_022518m|PACid:17964927 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_022518m|PACid:17964927
Domain Number 1 Region: 425-592
Classification Level Classification E-value
Superfamily BRCA2 helical domain 6.93e-41
Family BRCA2 helical domain 0.00047
Further Details:      
 
Domain Number 2 Region: 593-722
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 3.6e-34
Family Single strand DNA-binding domain, SSB 0.00012
Further Details:      
 
Domain Number 3 Region: 725-754,873-956
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.63e-24
Family Single strand DNA-binding domain, SSB 0.0063
Further Details:      
 
Domain Number 4 Region: 755-873
Classification Level Classification E-value
Superfamily BRCA2 tower domain 1.33e-18
Family BRCA2 tower domain 0.0036
Further Details:      
 
Domain Number 5 Region: 964-1097
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000103
Family Single strand DNA-binding domain, SSB 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_022518m|PACid:17964927
Sequence length 1100
Sequence
MSTWKIFSDTGNNFRWEPSGQIIHRRPLHGPNNPPIQPRCSTPRLPSMADVLRQECSPLL
ENGEEDIEHAPMFRTGLGNSVALKQSSIAKALSILEDNDNAISSGETHSTDNDCGFNNSL
FCTGSGKSVNVSSAGLFRAKALLGLENNNDVSISQVFQHPRKSSNSNATEEHEWQGLSHL
RMKESTKNSSMESVPRPSLISKASSIGSKLSNVVNQNLLQPELHNSISKPPPIKFHTAGG
RSLSVSSDALERAKSLLGDPDFGALLNEEDVVDPALSVYKESRFNDASSTKETDFRAFTY
PGTAKSKQISKIFTSPMRLSTKHIQSSLNSENIVSGISLIKKFDAVDDDKFYRLDNTSPF
PQRPLSNGSSKTDMVEDKSLEICDVSRINQNVRSSRGPLVDISNTIGTVYTNNEKRRFGR
GSSTSPFKRPRSSKFTTPLNRNVSYAPSGLSASSSENSCCRRMISTRYPFQIPRMYMKEY
FGVPSSDKGLLEHLADEVRRIKPETAEKYTFCDESGLNYIGGEAFYHMLVQSGASVQYAS
KQWIANHYKWIVWKLACYERCYPLKSATRFLTVTNVLEELKYRYEREVNHGHRSAIKRIL
EGDASPSSMLVLCISAICISCEPKIENVAVNGGECTSGAKVELTDGWYSIESLLDVPLSK
QLAAGKLFVGQKLRIWGAGLCGWVGPVSPLEVLAPRTVSLSLHINGTYRAHWSDRLGFCK
DAGPPLAFRCIKSNGGLVPRTLVGVARIYPVLYKEKFITGGSIVRTERMEAKTLQSYNQR
HSAVVEGIVSEYQRGMKGSYICNDSDSEEGAKILKILETAAEPEVIMAEMSPEQLTSFAS
YQAKLEAIKQLDMEKAVKKALQDAGLAERDVTPFMRVRVVGLTNYQDKCFPKEGLITIWN
PTEKQQNELVEGQAYAVEGLSPVNSDSNTLYLQARGSTTKWRPLSPFTVQRYQPFFSSRV
SVLLSNLGEVPLSSEFDTAAYVVHVGEVYTTAQWKRQWVFVTDSSISTLDLEEMSNSLLA
ISFCSPYIDGDSFTPINYNLAGSTVSFINLIKKAKDQINNLWIAEATENSIYSLSFDSPN
CSHLKNAAASAQSWAKTSSL
Download sequence
Identical sequences cassava4.1_022518m|PACid:17964927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]