SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_022877m|PACid:17973703 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_022877m|PACid:17973703
Domain Number 1 Region: 106-214
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.19e-30
Family B3 DNA binding domain 0.0000147
Further Details:      
 
Weak hits

Sequence:  cassava4.1_022877m|PACid:17973703
Domain Number - Region: 248-295
Classification Level Classification E-value
Superfamily Prion-like 0.0188
Family Prion-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_022877m|PACid:17973703
Sequence length 430
Sequence
MDFGSGFSEEDQMSKGKIPFSYSSSSSPSSSSSQHKGNLLPLSQIYDNPKPQMGSWLGSK
YDPVQEDTSRFNDSGAAVKLELMDVNDEQKQGIQEESASVAVIEKEHMFDKVVTPSDVGK
LNRLVIPKQHAEKYFPLDSSTNDKGLLLNFEDRTGKAWRFRYSYWNSSQSYVMTKGWSRF
VKDKKLDAGDIVSFHRGVGETGKDHLYIDWRRRPDAPDTTSHNPQHRHQQHHHFSSIPWS
PLLMRPPMVPMMRRDHLHFSNPDRNAYYNSGGGGGSYYGYGYNSCNYSNMNANHCPPSGT
IIYRRSTAPQQLGMGMVQWQQQGVGGVVEPMVYESVPVVQGKAAAKRLRLFGVNMDCPIT
DSEECDELSSATAIPPPHHATTALQAPQISSSSHHALQLRLYNGTPLPPITSSTQFFHKG
KSSTSLDLDI
Download sequence
Identical sequences A0A2C9WGT1
cassava4.1_022877m|PACid:17973703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]