SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_023093m|PACid:17985435 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_023093m|PACid:17985435
Domain Number 1 Region: 22-119
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.14e-20
Family B3 DNA binding domain 0.0015
Further Details:      
 
Domain Number 2 Region: 229-303
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000153
Family B3 DNA binding domain 0.013
Further Details:      
 
Weak hits

Sequence:  cassava4.1_023093m|PACid:17985435
Domain Number - Region: 117-146
Classification Level Classification E-value
Superfamily Leech antihemostatic proteins 0.0283
Family Huristasin-like 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_023093m|PACid:17985435
Sequence length 305
Sequence
MEEGASRDCRSWNEEIYWTHFQYVHFSRFLHAGFDQCLCMKLQAIPENFTRNLPRKLPNT
VTLKSPSGIKWEIGLTANDNSLFFEHGWKEFVKYHSLEENDILVFKYNGESHFDVLMFNG
WSMCEKTACYFLRKHGPKEHDSGCQIKRESGKKSAGVVIGSCPKKKPKNKNIHTPLKQPV
ISKFAKNVTAGNKEPCDEDIEAKPDIKHREKEIQCVLQLAHATLTDKGFIVMMKPTHVSR
KFFMSIPSAWMTKHISCRENQDVILRMKENTWRTRLYYRRKPNRGGLACGGWRSFVLDNK
LREFD
Download sequence
Identical sequences cassava4.1_023093m|PACid:17985435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]