SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_024104m|PACid:17991311 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_024104m|PACid:17991311
Domain Number 1 Region: 111-181
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000114
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_024104m|PACid:17991311
Sequence length 186
Sequence
MKEQAAVHEKPEARAWVAGGDGVAAEGDKVRGGSDRSWVGHGGDLVSMVGFDVKRKKRMP
RQRRQSSSINYLFSFPNTVTVSSSCCSSSAATTSHVPSSSPLHHLPSFPTRKAAEAHLPI
LESKEGIFISMDDLDGLHVWSFKYRYWPNNNSRMYVLENTGDFVNTHGLQLGDFIMVYKD
DQNQNY
Download sequence
Identical sequences cassava4.1_024104m|PACid:17991311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]