SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_024894m|PACid:17976320 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_024894m|PACid:17976320
Domain Number 1 Region: 146-247
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.01e-23
Family B3 DNA binding domain 0.00077
Further Details:      
 
Domain Number 2 Region: 28-85
Classification Level Classification E-value
Superfamily DNA-binding domain 0.0000000000000019
Family GCC-box binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_024894m|PACid:17976320
Sequence length 318
Sequence
MQSSNLNIMNRNQQSTKHCSSSARGSSSKLKGVISLKSGKWGARIAFKYKAHWLGTYDLE
EEAAMAYDRAAIKLQRSDAPLNFPMTIYSVQETKFQSRYSNESILDMIKSKTYMSKFTSY
LADQSLMREHAARNQANQQHGISYQMLFRKELTQTDVTHIKGFHIPKEYAMQYFPPLAGV
SSAGGGDENGSKSIELTFFDRHCRPWTFRYSYWKSTQTFVFTKGWKHFLRMNNLKPKDCV
FFYRCEYQRETQKRVFYMIDAQCSSVETDAVTGNLDKERNAKKRSNNEVDAEDIEEQETD
DGVKLFGVQISKKKKTKL
Download sequence
Identical sequences A0A2C9WJH9
cassava4.1_024894m|PACid:17976320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]