SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_025987m|PACid:17983320 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_025987m|PACid:17983320
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.05e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.0012
Further Details:      
 
Domain Number 2 Region: 146-233
Classification Level Classification E-value
Superfamily S13-like H2TH domain 4.58e-25
Family Middle domain of MutM-like DNA repair proteins 0.0026
Further Details:      
 
Weak hits

Sequence:  cassava4.1_025987m|PACid:17983320
Domain Number - Region: 204-321
Classification Level Classification E-value
Superfamily Variable surface antigen VlsE 0.085
Family Variable surface antigen VlsE 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_025987m|PACid:17983320
Sequence length 359
Sequence
MPELPEVEAARRAIEEHCLSKRIKRAIIANDPKVIDGVSSADFEAALVGKTLISALRKGK
NLWFQLDSPPFPSFQFGMAGAIYIKGVAVTKYKRSAVNDTDEWPSKYSKLFIELDDGLEL
SFTDKRRFAKVRLLNDPASVPPISELGPDALLEPMEVDEIYESLRKKKIAIKALLLDQGF
ISGIGNWIADEVLYQARIHPLQTASSLSKESCATLLKCIKEVIEKALEVGADSSQFPNNW
IFHSREKKPGKAFVDGKKIDFINAGGRTTAYVPELQKLSGGQAVKVAAKSKRQTPKRKKG
EDDNDEGEDDASEPGSDKEEAARKAKSRRELKPRGHVKKPPAKQKSEATDDVDDEENDN
Download sequence
Identical sequences cassava4.1_025987m|PACid:17983320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]