SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_026225m|PACid:17970464 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_026225m|PACid:17970464
Domain Number 1 Region: 16-62
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000145
Family B3 DNA binding domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_026225m|PACid:17970464
Sequence length 80
Sequence
MDSPSCGGILRIRLNYDSGNVWSFRCRIPAIGFSKPVVFGNWFKFVRSKDLKPRDTIVFY
KEMDECSGAQYKIEVKKRDQ
Download sequence
Identical sequences cassava4.1_026225m|PACid:17970464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]