SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_028468m|PACid:17984493 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  cassava4.1_028468m|PACid:17984493
Domain Number - Region: 7-87
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0102
Family B3 DNA binding domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_028468m|PACid:17984493
Sequence length 121
Sequence
MANRTTSKLLTEADLKDCQLLISTGRPLVEEEGHAMGMKIYDKDGTYLSLPCSIYQRSDN
LEIILAVNCNDFIREKGLAVNDKIILSEETMQDQAPRTYRVRIDVEIYAFRLFGVDIWQN
L
Download sequence
Identical sequences A0A2C9V5P0
cassava4.1_028468m|PACid:17984493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]