SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_030248m|PACid:17986136 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_030248m|PACid:17986136
Domain Number 1 Region: 167-264
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-27
Family B3 DNA binding domain 0.00017
Further Details:      
 
Domain Number 2 Region: 46-102
Classification Level Classification E-value
Superfamily DNA-binding domain 0.00000000000000262
Family GCC-box binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_030248m|PACid:17986136
Sequence length 357
Sequence
MGKDIVSMISSGETAVIEEVSDSNSTTYPSLMSREARLDKSICTTKFRGVVAHQNGHWGS
QIYFDHQRIWLGTFKSEKEAAMAYDSAALKLRSGDCRRNFPFTNVTVEEPKFQNLYSTEA
VLNMIKDGTYQHKFADFLMTCTQNSNADLSPKLMKTQSKRILTCKQLFQKELTPSDVGKL
NRLVIPKKFATKFFPSMSEVDQENGVDDRQLAFYDKAMKLWKFRYCYWRSSQSYVFTRGW
NGFVKEKKLKANDTICFSLCECRENSKVTQTYCMIDVKNGEERSSLLGLGSQWVDMGVEL
QLQLHLGQSCGQDCIEKMEEEEEEEEEVVERGGLVMAEPRSECADTKGFRLFGARII
Download sequence
Identical sequences A0A2C9VMK6
cassava4.1_030248m|PACid:17986136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]