SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_031243m|PACid:17965734 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_031243m|PACid:17965734
Domain Number 1 Region: 68-165
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000192
Family B3 DNA binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_031243m|PACid:17965734
Sequence length 215
Sequence
FAESMVEEKKSEQCFESVNNTAEDHQHKKKKLLKRLNFEELGLDPPPELPSEWMNKIEKK
GGVDVKLVIMKQMFPTDLNPHHDRLSIPFRQIRNEFLTEDEKTKLIEQKSITVKLMEPCG
SESELYLRQWNLKNTSCYALTTRWKQVIKEFKQNDIIQLWSFRVQGELQLALIKVPYASA
SASASASTDVNGGGGGGGVSLKNQFCMCLERTKTT
Download sequence
Identical sequences A0A2C9VD50
cassava4.1_031243m|PACid:17965734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]