SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_031416m|PACid:17959850 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_031416m|PACid:17959850
Domain Number 1 Region: 8-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.42e-22
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 416-510
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-18
Family B3 DNA binding domain 0.0076
Further Details:      
 
Domain Number 3 Region: 143-222
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.29e-16
Family B3 DNA binding domain 0.0086
Further Details:      
 
Domain Number 4 Region: 313-388
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000255
Family B3 DNA binding domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_031416m|PACid:17959850
Sequence length 514
Sequence
MATEKILSSKPHFLQPVLPGFKHQQFSIPVSFFKYLKGQKCERAILRGRTGKIWPVKINS
RSFEDGWKDFVEDHDLHVGDFLVFRHEGEMVFDVMVFESSACLREYPSFPAKEFDIKEEE
IEFQEEQLAQKSSPVSKFYTSEQHIPIKFARTHGLCNSNCKMILMNEKGRSWPAVSWNKK
SDGQVYIGRGWTSFRDANNLKAGDSFIFKHIEKQKIPTFKFHRFYEGLLQANTEAKMEPT
YQEVHAGSLSIRHHHISVSKKVSCPGNSEVKTAEEVEKECRPRKPKKKQQCATNYEVKAS
SSVLEQPYFVAKYIPTTFARLNNLNNRRCKMILVDAKGRSWPAKLWHKTSDGRAYIHDWN
AFRVANDLHPGDSFILELVDKGEMPVFKMSMMKVNTKTDSEMIHQDGEASSSSIRHPYFY
VTVKAYHIQNSYLQIPSDFARRNDLIGKCSEMILTNERGNSWVVSLETGKDGKVYIGCGW
SEFAKANGLRERNIFMLELVEGGNKPAMKFYGKF
Download sequence
Identical sequences cassava4.1_031416m|PACid:17959850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]