SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_031569m|PACid:17992125 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_031569m|PACid:17992125
Domain Number 1 Region: 147-260
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000981
Family B3 DNA binding domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_031569m|PACid:17992125
Sequence length 264
Sequence
AQASMKDQLFVANQSDKKRNHRYIIDVQENNVVSTELTLHCGFPSMIKKPRTTPISSSSF
LHSSIIVSTRPAKEKVSTKLKLFDETLVADHDASATRKEPDGVSKESSELKTLARDTANK
RIYSPEEERKMRLKHPVWTKLVLYDPWKIKKRLTGSDLGNHCRLLVASALVKNHIFPFMG
SEMVEKIRGEGAEFCFWDCDTNIGLNLVLKYWHTSKSYIFNKGWQNNFVKRRHLVEGDLI
GIYWDFTKKIFNFAVLERACEVYP
Download sequence
Identical sequences cassava4.1_031569m|PACid:17992125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]