SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_032104m|PACid:17993510 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_032104m|PACid:17993510
Domain Number 1 Region: 127-233
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000301
Family B3 DNA binding domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_032104m|PACid:17993510
Sequence length 248
Sequence
MELSSTEPSSSEPSYDEKEAAEVLLCFKQAEDLLYLKHKKLDPLIAAALEETKSNKIRQG
TKSKKIRQGQQAKPQPQPRPEKPAAKPQLRPRLEKPAADTFFDTYEPPEIPPVVGLDGLI
GKCSKPFEKQLTSSDVRPDQSRLTMNKADVVRCLLPLLNREEENPCQGIKVKTYDMQGNE
YDMAFKLWASKVYVLTTGWKNFFIKHGLIENEDFVTIWMFRNLQTNKLCFVISSRRLPIY
EPIKRRRG
Download sequence
Identical sequences cassava4.1_032104m|PACid:17993510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]