SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_000104m|PACid:17981547 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_000104m|PACid:17981547
Domain Number 1 Region: 215-451
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000536
Family Tropomyosin 0.00096
Further Details:      
 
Domain Number 2 Region: 414-632
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000719
Family Tropomyosin 0.00086
Further Details:      
 
Weak hits

Sequence:  cassava4.1_000104m|PACid:17981547
Domain Number - Region: 732-840
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000366
Family Myosin rod fragments 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_000104m|PACid:17981547
Sequence length 1780
Sequence
MAAVSHGDSKRKYSWWWDSHISPKNSKWLQENLTDMDLKVKQMIKLIEEDADSFARRAEM
YYKKRPELMKLVEEFYRAYRALAERYDHATGALRQAQRTMAEAFPNQVPFILTDDSPAGS
ADGEPRTPDMPPIRALFDPDELKNDALGISPSYSHALKRLGAFTEESDSVPVRKSLKQFN
DLLGTGEARARKGLSFHDAEENDHGVQDNDKNDIKSRVPSDSQRVGKAELEIATLKDTLA
KLEAEKEAGLLQYQQSLQRLSNLESEVSRAKEDSKGLNERASKAEAEVQTLKEALTKLEA
EREASLLQYQQCLDKITNLENIISHTQKDAGELNERASKAEVVVQSLEQELANLEAEKEE
FLYQYKECLEKISDLEGKLLHAEDDARKCYERADKAEREIETLKEMLAKLTDENEAAATQ
YQKCLDTISSLEQKLAFAQEEAQRLKSEVDDGVVKLKGAEEKCLLLERSNNTMHSELEYL
AQEMSAQSEELTEKQKELGRLWTCIQEERLRFVEAETAFQTLQHVHSQSQEELRSMAAEL
QNRARILQDLEARNQSLQHEVEQVKVENKGLSEVNLSSNLTIQDLQEEISNLRQTIGRLE
AEVELRLDQRNALQQEIYCLKEELNDINKKNQAIMDQVDSVGLSPECLGSSVKSLQDENI
KLKEVCVRETDQNVALLQKLEIMEKLAERNALLENSLSELNVELEGVREKVRVLEESCQS
LLEEKSTLVSEKVTLVSQLQVATDNVEKLTEKTNFLENSLFDANAEVEGLRIKSKSLQDL
CMLLDNEKSDLATVKGNLMSQLNITQKRLEDLEKNYRDLEEKCSTLEEERESTLHEIEEL
YVRLNAQKQEHASLAQLSESQLAGMATQVRMLQEEGQCIKKEHEEELDKAFYAQTEIFIL
QKCMQDLEEHNSSLSIERQKLLEESKLSEKLISELKHENLEQEVEVKSLYDKIEVLRVGL
YRVLKTLGLDGKQGCEDKAEQDQMLLNYALDKLLETQRFLLEMQDENQQLGIENTILVTL
LGELQWELANLTAAKNTLDQELASRSEQFLVLHGESQKLADVNEELSLKIIEGEHKEETL
KAQLKTMHGQLLDLQGDCQNLQKENCKLVDEQRLLMKSLSDLGEEKCNLEDENFTIFAET
LSLSTISLIFKDIISEKHSEIKELSENLDKLHVVNNGLDEKVKIMEGKLLELSIIKDEKR
ELYKMVEDLKCKRDEVELIRADQEKQIIKLSGDCDEQSKEIECIQKANWEMKAELGKLNG
ELLETKVREEILNRELQKGRNEAEWWESQAVALFGELQISAVQQALFEGKVHELIELCEN
LEGRNCLKAEEIDQMKERVSTLEHENEELKSQMTSYVPAFISLTDCIASLENHTLSHPTL
HEHKEAKDTPFVVHAESCQRICDDQTAMGQGGLLEVEGLRMRIIAIQEAVEERERFVILE
KSEAYSKLAEAIRQIEELKSRSSLHEEAVVSSKKGNQNPEDKGLGSAAYYNLRLQKPTHE
TSEEGSEVMTKDIMLDQISESSSYGISRRDTPEADAPMLEIWQTTEQDAAIDLTVGKAQK
QTAASTEKKGKKELTSMESMVEKDVSVDKLEISKRLSGSRQDVNERKILERLDSDAQKLT
NLQITVQDLKRKVEITEKNKKGKGNEYDSVKEQLEESEEAITKMFEVNLQLMKSIEDEQL
SIDEKSALASDENGSARKRRISEQARRGSEKIGRLQLEVQKLQFLLLKLDEENKSGGKTK
IIESKTRVLLRDYLYGGTRTSQKKKKRHFCACVQPPTEGD
Download sequence
Identical sequences A0A2C9WMD6
cassava4.1_000104m|PACid:17981547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]