SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_000217m|PACid:17971013 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_000217m|PACid:17971013
Domain Number 1 Region: 297-560
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000719
Family Tropomyosin 0.001
Further Details:      
 
Domain Number 2 Region: 517-746
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000418
Family Tropomyosin 0.0028
Further Details:      
 
Weak hits

Sequence:  cassava4.1_000217m|PACid:17971013
Domain Number - Region: 188-317
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_000217m|PACid:17971013
Sequence length 1484
Sequence
MIFKLLKEEDIEEKDGLSVENSKKEPLVELIEDFHKHYQLLYEQYDHLTGELQKKFRGKQ
GTESSSSSSSDSESEYSSKDKGSKNGKLENEYQKIADVIKQELEMTNLEVAELKSKLTAT
NEEKDALNLEHQAALSKIQEAEEIHKKLKFEVERLDVEKENLLVENGELKQNLDKAGNIE
AELNKRLEEMKKEKDNLIVEKETAIKRFEEGEQTTEELKVVMSQLQEEKAVLGQELESYR
AEVASMKQQLESAEQQVSDFSQKLTQYEEENRSITSSILVQNSRLEDMTREKDNLLREKE
TAVRRIEEIEKTTEDLRTLADRLQDEKTMLGQEIETLREEHTSRKQQLESTEQMVSELNH
TLEVAEKEKEVLGQELEGLRAEIASMKQQLESAELQVSDISQKLTHSEEENKSLTSSVLV
QNSRLEDMAREKNNLLMEKETAVRRIEEIERTIEDLRTLADQLQDEKTMLRQEIETLREE
LTSRQQQLGSTEKMVSELNHTLEVADKEKVVLGQELESFRAEVTSLKQQLECAELQVSDL
SQKLTHYEEENKSLTSSVSVQNSRLEDMTREKDNLLMEKETAVRRIEEIEKTAEDLRTLA
DRLQDEKAMLGQEVETLGEELTSRKQQLQSVEQMAADLNHSLEVAEKEKVILGQQLENFR
AEVASIKQQLESAEQQVSNLSQKLTHSEEENKSLTSSILVQSSRLEDMTREKDNLFMEKE
TAVRRIEEMEDTAEDLRTLADRLQDEKAMLGQEVETLREELTSRKQQLESVEHMASDLNH
SLEVADKENVSLTLKVTEISNEIQLAQNTITELMSESRQLKEKLIEKEKELSSLAEMLKA
HSNESSTQIKELEALVTGLKLELESLRAQNRDLEVQVDSKTSEVKVVEADNLQLKAQILE
LEMISKERGDELFALTKKLDDNEKESLSRVEILTAQVNTVLADLESLRTQKAELEEHMIS
KGDEASIQVKGLMDQVNGLQQQLVSLHNEKAELEVQLEKKTHEISDFLVQKENLKEEIAH
RTEDYQRMFGEKEILTLQMKNLELEVETLRNQKTDLEDQVRTQIKESGRLGEEIVGLQNR
IFELEKTLTERELEFSALQERQEKGENEASVQIMALTTQTDNLRMELNSLLAEKNQLQLQ
LDKEKQKFSESVTEMENQKSEFMSKIADQQKMLAEQEGAYKKLTEEYKQVESWFQESKEN
LKATERKVEEMAKEFQKNTESKDQIVAELEEIIEDLKRDLEVKGDDLNTLVENVCNIEVK
LRLSNQKLRVTEQLLTEKEESFRKAETSYQKELGVLGERIATLSGIIAATNEACQRMVTD
MSEKVNSTLTGAEAMTRKFEEDCDSIVQCILGMSNEIEIAKNRVIVMKNEKERLRKEVGD
LVLQLQVTKERESALREKVEQLEFNVRKDEGEKENLTKAVNQLEKKVAALEKMMKEKDEG
ILDLGETKREAIRQLCLWIDYHRSRCDHLREILSKMPVRGQRAA
Download sequence
Identical sequences cassava4.1_000217m|PACid:17971013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]