SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_000279m|PACid:17974467 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_000279m|PACid:17974467
Domain Number 1 Region: 619-870
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000036
Family Tropomyosin 0.00054
Further Details:      
 
Domain Number 2 Region: 393-616
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000085
Family Tropomyosin 0.00098
Further Details:      
 
Weak hits

Sequence:  cassava4.1_000279m|PACid:17974467
Domain Number - Region: 876-1055
Classification Level Classification E-value
Superfamily Tropomyosin 0.000785
Family Tropomyosin 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_000279m|PACid:17974467
Sequence length 1381
Sequence
MEVDSQMASEVPVLKADTEEKADTVNVTNGDLPQVEKAGKKEEDETDGEFIKVEKESLDV
KDASPTVEPANADEEKPSATDGSLSSSTRELLEAQEKVRDLELELERVADALKHSESENT
KMKEEVLLANEKLEIGEKKYVELELDHRKLQEQLIDAEEKYSSQLGTLNEALQAQDMKHK
ELTEVKEAFDSLSLEVESSRKSLQELEQKLQFSEGEAKRFEELHKQSGSHAESETQRAVE
FERLLEEAKSSAKEIEGQMASLQEEVKSLYEKIAENQKVEQALKDTTAELATVNEELALS
KSQLMDMEQRFSSKEVLISELTQELDLRKASESQVKEDILTLENLLTTTKDDLQAKVSEL
EGTRLKLQEEVNARELVEAAIKDHQGQVSAIREELAKVIKEKEALEATVTDLTSNAAQMK
ELCNDLEDKLKVSDENFSKADLLLSQALSNNAELEQKLKSLEEVHIAAGAAAASATEKNL
ELEDSIRASHEAVENVNSQLRELETCLIAAEQRNVELEQQLNLTELKSSDAERELREFSL
KITDLSAALKELEEEKQKLSHQMQEYQEKINHLESSLNQSSTRSTELEVELRIATEKCAE
HEDRANMNHQRSLELEDLFQLSNSKVEDASKKVNDLELLLEAEKYRIQELEEQISTLENK
CVDAEAESNRYFNRVSELTAELEAFQAKASSLEIALQTANEKERELMESLNSATDEKKKL
EDASIDSSQKLADAENLVEVLRNELTVMQEKLEGIENDLKAAGLKESDAMVKLKSAEEQL
ERQEKLLEQATARHSELESLQESLATDSELKLQEAIEKFTSKESEAKTLVEKQMILEDQV
KLYEEQVAEATRKSAFLKEELDLCLLKVASMETSNEELKKQIIEVENRASNTSSDNELLV
ETNNQLKSKVNELQELLNSAVSEKEASSQQLASHMNTITEISDTHSRALELHSATEARMV
QAEAELQEAIQKLTQKDAETNNLNEKLNALEGQMKLYEEQAHEASAIAETRKLELEETCL
KLKHLESIVEELQNRSSHFEKESAALAEANLKLTQDLASNESQLSDLQSKLSAAESEKDE
TVEQLHNSKKALENLTQQLTDEGQKLQSQISSVMEENNLLSDTYQNAKKELESVIIQLEG
QLKDQKANEEALKSEIENLKMEVAEKSALQTRVKEFEEKLAAAEARLKEEVESIQASAAG
REAELTLKLEDHAKKVHDREMLNDQVLQLQSELQLAQSIVTAQKEANSQKDLEREAAMRK
SLEDLDAKNKAIILLENKVKELEQKLQLADEKLLHKDDGGNLAEHNDGTEIKSRDIGSMI
SAPTKRKSKKKLEAAATAQTSSSSSEMHVQTKEVSQGMNIKFILGVGVVSIIIGIILGKR
Y
Download sequence
Identical sequences A0A2C9V8L8
cassava4.1_000279m|PACid:17974467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]