SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_000604m|PACid:17965279 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_000604m|PACid:17965279
Domain Number 1 Region: 116-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 6.67e-44
Family B3 DNA binding domain 0.0041
Further Details:      
 
Domain Number 2 Region: 1003-1065
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000981
Family PB1 domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_000604m|PACid:17965279
Sequence length 1114
Sequence
MKVPPNGYMPNSAEGERKTINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMQKE
ADFVPSYPNLPSKLICMLHNVTLHADAETDEVYAQMTLQPVSKYDKEALLASDMGLKQSR
QPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFSMQPPAQELGAKDLHDNAWTFRH
IYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIRDEKSQLLLGVRHANKQQSALSSSVIS
SDSMHIGILAAAAHAAANNSPFTIFYNPRASPSEFVIPFAKYSKAMYTQVSVGMRFRMMF
ETEDSGVRRYMGTITGISDLDPVRWKKSQWRNLQVGWDESAAGERPSRVGIWEIEPVITP
FYICPPPFFRPKFPKQPGMPDDESDIENAFKRAMPWLGDDFGMKETPSSIFPGLSLVQWM
SMQQNNQFPAAQAGFFPPMLPSNALHSTLGSDDPSKLLNFQAPGLSVPSLQFNKANPQNQ
VGQLPQPSMAWTQQQQLQQFLQTNISQQQPAQPQQLQQQPHPQQQQRQEPQQQQLSQQPQ
PEIQPRQIRQQHPQLEQQQQQQIFQPPVNSGVTANSISNQNLQQPMVYSQLQQQQQQQLL
ASNTQSQNIPPANKSSYQLSSLPQDATLQQQMEQQSTLLQRQQQQTQLQQSPLQLLQQNL
SHRTQLPLPQQQVQQLSQPSLSEQQLHLQLLQKMQQQQQQQQQLLSPTSSPLQPQLLQQQ
LNHQQNQQFQQSPVSQSQPQGSNSFSTAALGQSQSFPVCHSHVLQKPPTTNRAHSTLTDG
DAPSCSTSPSTNNCQISPSNFMNRNQESPAILMGDQVVEPGTNLVQELNNKSDIRVKHEF
QSSKGLEQLKYKGTVPDQLEACSSGTSYCLEAGNIQPNFSLLTYGLDGDIQSHPRNSMPF
AANIDSLAPDTLLSRGYDTQKDIQNLVTNYGGTPRDIETELSTAAISSQTFGVPNIPFKP
GCSNDVAINDSGVLNGGLWANQTQRMRTYTKVQKRGSVGRSIDVTRYRGYDELRHDLARM
FGIEGQLEDPQSSDWKLVYVDHENDILLVGDDPWEEFVSCVQSIKILSSAEVQQMSLDGD
LGSVPVPNQACSGTDSGNAWRGHYDDNSAASFNR
Download sequence
Identical sequences A0A2C9W4F9
cassava4.1_000604m|PACid:17965279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]