SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001328m|PACid:17972625 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001328m|PACid:17972625
Domain Number 1 Region: 112-256
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.81e-49
Family B3 DNA binding domain 0.0061
Further Details:      
 
Domain Number 2 Region: 765-847
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.000000392
Family PB1 domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001328m|PACid:17972625
Sequence length 905
Sequence
MRLSSVGFNPQTQEGEKRVLNSELWHACAGPLVSLPAVGSRVVYFPQGHSEQVAVSTNKE
VDAHIPNYPSLPPQLICQLHNVTMHADVETDEVYAQMTLQPLSPQEQKDAYLPAELGAPS
KQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVFPPLDFSQQPPAQELIARDLHDNEWKFR
HIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRTNRPQTVMPSSVL
SSDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYFKAVYHTRVSVGMRFRM
LFETEESSVRRYMGTITGISDLDPVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLT
TFPMYPSPFPLRLKRPWPPGLPSFHGIKDDDFGMNSPLMWLRGDGDRGIQSMSFQGLGVT
PWMQPRVDASMLGLQTDMYQAMAAAALQEMRAIDPSKSSTTSLLQFQQHPNLPSRTAALM
QPQMLQQPQSQQAFLQGVQENQHQPRTQVQTQSHLVQQQLHSQHSLNGPQQQPQQQQQHP
LSQQQLVEHQQIPNVVSAMSQFASASQSQSPPLPAISSLCQQQSFSDSNGNPVTSSVVSP
MHSLIGSFSQDESTHLINLPRTSALITSSAWPSKRAAVEPLISSGAPQCVLSQVEQLGGP
QTNISQSSVSLPPFPGRECSIDQEGGTDPQSHLLFGFNIEPSSLQLQSGMSSLRGVGSDC
DSTTIPFSSSNYMSTTGTDFSLNPAMTPSSCIDESGFLQSPENVGQVNPPTRTFVKVYKS
GSFGRSLDITKFSSYNELRSELARMFGLEGQLEDPLRSGWQLVFVDRENDVLLLGDDPWP
EFVNSVWCIKILSPQEVQQMGKRGLELLNSVPIQRLSNGSCDDYASRQDSRNLSTGITSV
GSLDY
Download sequence
Identical sequences A0A2C9U6V8
cassava4.1_001328m|PACid:17972625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]