SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001569m|PACid:17970131 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001569m|PACid:17970131
Domain Number 1 Region: 332-434
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.58e-20
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001569m|PACid:17970131
Sequence length 857
Sequence
MSAAPSTSSSSTSKKCFNSDCVDFKSRKGWRLRSGEFAELCDRCASAYEEGRFCETFHLS
ATGWRCCDSCGKRVHCGCIVSIHAFTLLDAGGIECMTCARKNIVLTSNSAWPPSFFYNTP
LSERFKDLSVKSWSQLAGSGPVPWRQAPSLFNSSIPHSELHPRNLYEIDRLNPSERSSAP
SLEKGRVEDFPDRLVNGSLKLGTRDILENGNAGTSSEEKPGVCLGISQHPVLKEDPSTPQ
LGMAISFASLNESNGQIGGLGTPLRQTAPPLLAKQFHGNLHNGVDSSPDTQIRIGRPRAD
ARGRSQLLPRYWPRFTDEELQQISGNSNSVITPLFEKMLSASDAGRIGRLVLPKKCAEAY
FPPISHPEGLPLKVQDSKGKEWVFQFRFWPNNNSRMYVLEGVTPCIQNMRLQAGDIVTFS
RLEPEGKLVMGFRKASTAPSSDLVELVDPSPWSKVDKSGYIAKEVLEAKSSIKKRKSSTL
GSKSKRLRIENEDMIELKLTWEEAQRLLRPPPDHVPSVVMIEGFEFEEYEDAPILGKATI
FATDNLGQKIQWVQCEDCFKWRKLPANALLPSKWTCSSNSWDLERSLCSAAQELTAEQLE
DLLPSCNLAASKKMKAAKQDAENEALEGLDTLANLAILGENEALPTSSQATTKHPRHRPG
CSCIVCIQPPSGKGPKHKQTCTCNVCQTVKRRFKTLMMKREKKQSEKEAETTRKKQQETL
PEKLLDDDPSPSTNTGSSSPNKKKVVSEGSDDDPNRSKSSTSPFKGQIDLNIQPEREEEL
SPGSDCGSMMKMLQDARQQMLSSDGDNISAGNQLLAGHGMGENISNGISLGTIHQESQKD
HPSAFSMKVSASSPAAG
Download sequence
Identical sequences cassava4.1_001569m|PACid:17970131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]