SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_001716m|PACid:17980848 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_001716m|PACid:17980848
Domain Number 1 Region: 1-63
Classification Level Classification E-value
Superfamily SAP domain 1.5e-16
Family SAP domain 0.0052
Further Details:      
 
Domain Number 2 Region: 110-169
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000399
Family PHD domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_001716m|PACid:17980848
Sequence length 832
Sequence
MDLVTSCKDKLAYFRIKELKDVLTQLGLSKQGKKQDLVDRILAALSDEQVPKTSVKKSAV
GKEEVAKLVDDIYRKMQISGATDLASKGQGVLDSSKAITKGDVDDSFHLDTKVRCPCGSS
LETESMIKCEDPRCRVWQHIGCVIIPEKPAEGNPQVPDLFYCEICRLSRADPFWVTVAHP
LYPVKLATSNIPTDGSNPVQSVEKTFHLTRADKDLLTKQEYDVQAWCMLLNDKVPFRMQW
PQYADLQVNGVPVRAINRPGSQLLGANGRDDGPIITPCIKDGINKISLTGCDARIFCLGV
RIVKRRTVQQILNLIPRESDGEHFEDALARVCRCVGGGAADNADSDSDLEVVAESFAVNL
RCPMSGSRMKVAGRFKPCAHMGCFDLDVFVEMNQRSRKWQCPICLKNYSLENVIIDPYFN
RITSKMLHCGEDITEIEVKPDGSWRVKTRTEAERRDVGELAQWHYPDGSPYGGEVKAKVE
MDKQIKQEGTSEGYAGTGLKLGIRKNCNGFWEVSKPEDVNTSSSGSRLREKFENHEQKVI
PMSSSATGSGQDGEDPSVNQDGGGNFDFTNNGIELDSLSLNVDSAYGFADRNFSAPVGDA
EVIVLSDSDDDNNILMTSGAVYKNNQADDDGADFSIPPPGTYPEDPAVGNGLGFLNADDE
FGMPMSLWQMPPGSQTGPGFQLFNSDGSDALVDLQHGPINCPMSMNGYTLAPDTVMGPAS
LVPDSSIGRSDADMNDGLVDNPLAFGGEDPSLQIFLPTRPSNASGQPDLRDQADVSNGVR
TEDWISLRLGGGGATGSHGDSVPANGLNSRQPMPPREGAMESLADTGLFPFL
Download sequence
Identical sequences cassava4.1_001716m|PACid:17980848

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]