SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_002960m|PACid:17968723 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_002960m|PACid:17968723
Domain Number 1 Region: 117-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.85e-30
Family B3 DNA binding domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_002960m|PACid:17968723
Sequence length 680
Sequence
MIRDFGVMKSQRVAEKCLDSQLWHVCAGGMVQMPPVNSKVFYFPQGHAEHAQGNVDFSHC
KIPAMIPCKVSAIKYLADPETDEVFAKIRLNPLSERDVFCLEDSSDGGLFDGTASPEKPA
SFAKTLTQSDANNGGGFSVPRYCAETIFPRLDYSAEPPVQTILVKDVHGETWKFRHIYRG
TPRRHLLTTGWSNFVNQKKLVAGDSIVFLRAENGDLCVGIRRAKRGIGGGNEYPSGWNSF
ADYSGFLREDENKLMGRNGNGDMKGKLKAESVIQAATLAANWQPFEVVYYPRASTPEFFV
RASAVRAAMQIQWCPGMRFKMAFETEDSSRISWFMGTISSVQVADPIRWPSSPWRLLQVS
WDEPDLLQNVKRISPWLVELVPNMPAIHLSPFSPPRKKLRLPQPPDFSLISQFPVPSFTG
NPLSSNSPLCCVSDNIPAGIQGARHTPFELSSADLHFNKLHSGLFPVGFQKLNHSAPTSR
IPSRNFMGITESNENISCLLTMGNPTLSSKESSETKEPHILLFGQLIFTEQQGSQRFSGD
TNGNSSSDGNPEKTTNFSDGSVSVFHQSCQLENSSDEGSPRYGDHWKTNLSSETSHCKVF
LESEDVDRTLDLSLVGSCEELHGKLANMFSIENSDMPSCVLYRDAAGAIKHTGDEPFGEL
LKTAKVLTLLSDSGSDNIGR
Download sequence
Identical sequences A0A251KJ90
cassava4.1_002960m|PACid:17968723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]