SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_004533m|PACid:17974506 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_004533m|PACid:17974506
Domain Number 1 Region: 118-257
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.79e-42
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 446-521
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000113
Family PB1 domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_004533m|PACid:17974506
Sequence length 570
Sequence
MAFTSTNHTPVGHPHAGGCNDALYKELWHACAGPLVNLPRDGERVYYFPQGHMEQLEASM
HQGLEQHMPSFNLPSKILCKVVNVQRRAEPETDEVYAQITLLPEPDQSEVTSPDPPLPEP
ERCTVHSFCKTLTASDTSTHGGFSVLRRHADDCLPPLDMSQQPPWQELVASDLHGNSWHF
RHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFLRGENGELRVGVRRLMRQQISMPSSV
ISCQSMHLGVLATASHAINTGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKM
RFEGEEVPERRFSGTIVGVGDNMSSGWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLV
ASAPSNSQPVQRNKRARPSVLPSPTPNLSALGMGDDCPIVSLDAESDQNSEPSNINRSEI
PSISCEPEKSCLRSPQESQSRQIRSCTKVHMQGIAVGRAVDLTRFECYEDLLMKLEDMFD
IEGELSGSTKKWQVVYTDDEDDMMMVGDDPWHEFCSMVRKIFIYTSEEVKRLSPKIKLPV
NEEIKATKADGDPDAAVNMEDQSSVVGPGC
Download sequence
Identical sequences cassava4.1_004521m|PACid:17974505 cassava4.1_004533m|PACid:17974506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]