SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_010068m|PACid:17962687 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_010068m|PACid:17962687
Domain Number 1 Region: 198-294
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.71e-32
Family B3 DNA binding domain 0.00000828
Further Details:      
 
Domain Number 2 Region: 67-123
Classification Level Classification E-value
Superfamily DNA-binding domain 8.5e-17
Family GCC-box binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_010068m|PACid:17962687
Sequence length 369
Sequence
MDGSCIDESTATSDSISVSISPTSAVSHFPPPTKSPESPLCRVGSGSSVILDSEFGVEAE
SRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAAKAYDIAAQRFRGRDAIT
NFKPQGEENEDDDIETAFLNSRSKAEIVDMLRKHTYKDELEQSKRNYLIDGQGKQHRNPG
ANNAALSGSGRVLKEREQLFEKAVTPSDVGKLNRLVIPKQHAEKYFPLQNVSNSTKGVLL
NFEDITGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIVSFQRSTGPDKQLYIDW
KVKTGPNPVVCSVKPVQMVRLFGVNIFKLAENNSGGAEGAGGCNGKRSIREVELSSLECI
KKQRIIGAL
Download sequence
Identical sequences A0A2C9VR17
cassava4.1_010068m|PACid:17962687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]