SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_012400m|PACid:17989033 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_012400m|PACid:17989033
Domain Number 1 Region: 19-116
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.75e-26
Family B3 DNA binding domain 0.0019
Further Details:      
 
Domain Number 2 Region: 207-304
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000122
Family B3 DNA binding domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_012400m|PACid:17989033
Sequence length 309
Sequence
MSSQGFQPKENDDTFNITAKIPQFFKIILQSTVLEGRLRIPKKFVKNHGKCLSSPMILKV
PTGNTWKVELLRSGDDVWLAKGWQEFTEYHSLKHGNMLVFKYEGDCQFSVLIFDMSAVEI
EYPDRDIHSGKETEKHENEEDFKGKVQNKRSKGNQSPVIDIDDSDCFIQESRGKSSKLRR
KRGVGKKPGRPPNSNISTDHESANKFTSSYPYFEAILGANGTGQIYVRVPTSFIRAHMKC
ETHAVKLKVAEKTWRVNLYINLQNSASKLCGGFTLFLRENGLKKGDVCIFELIGRRMMNV
HIIKRASDA
Download sequence
Identical sequences A0A2C9VKF9
cassava4.1_012400m|PACid:17989033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]