SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_022611m|PACid:17962458 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_022611m|PACid:17962458
Domain Number 1 Region: 3-94
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000497
Family B3 DNA binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_022611m|PACid:17962458
Sequence length 122
Sequence
MNPTHLFTKTLSSTDVKSALSVPCYALEFFPIPQGDHVMQFEAVDITGFIWRFRLSTRCT
GRYPKPVLLRSLWHFFVEKKGLVAGDRVMFFGEHDHENGTRYSVGTQRKIGRLFGKDLWV
DV
Download sequence
Identical sequences A0A2C9VJR8
cassava4.1_022611m|PACid:17962458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]