SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_022637m|PACid:17989488 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_022637m|PACid:17989488
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000000000194
Family B3 DNA binding domain 0.0035
Further Details:      
 
Domain Number 2 Region: 187-283
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000053
Family B3 DNA binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_022637m|PACid:17989488
Sequence length 289
Sequence
QIPGEFLRKCKEGLSSPVVLKLPDGAIWHLELLVCGHEVWLGNGWREFAGHYSLDFGHLI
LFKHLRDSIFNVVIFGRSATEIQYPCGRICAGKRRTQKPKREKNDYNQPPRKKRGKRSLF
LQLPEGTRTDSAIYQGEKPMPVMYKMSDLALATLSRPFSCNFQALQAVNSFSSEYPSFKI
VVRSYNWKHCNVVQIFTMDHCLICIQTIPRRFFRRYIEHRAEHAMLQVADRMYPVQFKPA
TSSGSITLSIGWRAFAAGNFLEGGDVCIFELIKNNILKVTIFRDVYQNA
Download sequence
Identical sequences cassava4.1_022637m|PACid:17989488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]