SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_024353m|PACid:17979599 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_024353m|PACid:17979599
Domain Number 1 Region: 83-212
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000126
Family BTB/POZ domain 0.025
Further Details:      
 
Domain Number 2 Region: 299-397
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000808
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_024353m|PACid:17979599
Sequence length 517
Sequence
MTWRSTLARNLNRLITPGDVEIAESIGSEASSSQNIFTASSHASNVLFTENQSIPLGFGA
SPSLEVLSLTKLSSNLEQQLIDSSWDYCDAEIVVEGLPVPIHRFILAARSRFFHELFKKE
KGPLDKEEKPRYLMSDLLPHGRVGYEALQVVLNYLYAGKLKPSPIEVSTCVDDLCHHDAC
RPAINFTVELLYASSIFLVPELVSLFQSRLVNFVNKAYVEDVIPILLVAFHCQASQLVAQ
CVNRIVRSDLDSILIEKDLPYQVSEEIKFLRKELTSDDEQKMEVVDPLREMRIRRIYKAL
DLDDIEQVKLVLADSDVTLDDANALHYAVAYCSPKIVDEVLSLGLANVNLRNSQGYTVLH
IAALQREPSVIMSLLAKGACASDLTLEGRSAVSICRRLTRPKDWHAKTVQGQEASKFRLC
IDVLERERQRNPTSTDVSITSLTLFDDLHRKLLYLENRVALARLLFPVEAKVTRDIAHAD
ENLKELDLNETPTAQKKRLVSRLEALAKTGTGSVEIC
Download sequence
Identical sequences cassava4.1_024353m|PACid:17979599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]