SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_025302m|PACid:17971686 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_025302m|PACid:17971686
Domain Number 1 Region: 581-675
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-22
Family B3 DNA binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_025302m|PACid:17971686
Sequence length 726
Sequence
MKNRLHVEDLQNVTNPSSGFDTVDAMEEEQAIADEDGEIWLEREQDDLLDVNDSSIFYDD
FPPLPDFPCMSSSSSSSSTPAPVKAMAPSSSCSSASSSSSAASWAVLKSDAEDDAEKKNN
YDSQHYHHHHSQYDQVEAPTAALSSTASMEIPQPSDQGVEGAGCTDMMETFGYLDLIEND
GFFDPSSIFQADEHFLDEFQQEQNMQPEQEPQQGNEELIMETKTEETQQQGAAASDDLAM
VFLEWLKSNKETVSAEDLRKVKIKKATIECAAKRLGGGKEAMKQLLQLILEWVKTNHLQK
RRMKESSSNYPPYQCQEPLQNPNPSASSNLNMNSNSIPPDQSTPCFTQSPWIAPPPYVVD
RGTLMPGISPMVGYMADPFASGASNMAGHSYPPAPPTDYHMLDSAQSWPPSQFALSSPYP
AFPDNNLQPVQAHHPVFTGYGNQYACQYLPGQVDDRLMRLGSSATKEARKKRMARQRRFL
THHRNQNHHNNQPIEHHQNQSADHHARLGNDNVALTAQPNPGNWVYWPAVSAVSTLPVLP
MDAQPVHIVDRPAMQAHESHQRQVASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLP
KKEAETHLPELEARDGISIAMEDIGTSRIWNMRYRFWPNNKSRMYLLENTGDFVRANELQ
EGDFIVIYSDVKCGKYLIRGVKVRQPGSKSENKKSGKSQKNLHASSPATALNGSSSTPIN
QAQTVK
Download sequence
Identical sequences cassava4.1_025302m|PACid:17971686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]