SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_026568m|PACid:17977720 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_026568m|PACid:17977720
Domain Number 1 Region: 10-101
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.35e-21
Family B3 DNA binding domain 0.004
Further Details:      
 
Domain Number 2 Region: 304-403
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 3.34e-20
Family B3 DNA binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_026568m|PACid:17977720
Sequence length 403
Sequence
MSGSKLNKCGYFYRLIVPSILQQNKLMIPRKFVRKFGDELSGVATLTVPDDRIWLVTIRQ
IDQKLWFCNGWHEFVVHYSICTGHFLVFRYEGNSNFSVHMYVLEPYRLKDPFTMMKTIKD
YSEQHHVFDEIDDGDSVEILGSSPARVACDHLKPKTFDEHVEPNTTCRNYNLPSPQNLHN
EASYHPSGDSVKLQPTVHSTQGIGSCTNELQNSVDDMRLELSHEKIQEHEKTMRKKLGID
EENLDPSNAADIAKRSREGKRKPTARRNVQGENRSRYYKRASVRKRTVTNEDQERVKTAA
AAFESVNPFCRVVLRASYLYRGCILHLPSCFARKHLNGVSDWIKLQFSDGKLWSVRCSYK
AGGAKLSQGWYEFSMNNGFAEGDVCVFELLNLRDTVLKVTVFR
Download sequence
Identical sequences cassava4.1_026568m|PACid:17977720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]