SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for cassava4.1_032427m|PACid:17962609 from Manihot esculenta v147

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  cassava4.1_032427m|PACid:17962609
Domain Number 1 Region: 13-120
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000114
Family B3 DNA binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) cassava4.1_032427m|PACid:17962609
Sequence length 133
Sequence
MSHSKEIIGDISNGAKVFSKQLGKTDKSHQLILPTKVLEQFPIQKGFYERDFTAFDGKGV
KWDFVLAIRHTGEYDKPFLRQSKWHEFVVAHDLYEEDIDYGIVFYINNEGKMQVTGLRRS
PYTLLGQPIWQQI
Download sequence
Identical sequences A0A2C9VHR3
cassava4.1_032427m|PACid:17962609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]